Sponsored Links

1.67 Rating by CuteStat

katypartysupply.com is 2 months 4 weeks old. It is a domain having .com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, katypartysupply.com is SAFE to browse.

Display Domain Stats or Pagerank Widget for this domain on your website. Click Here
Get Widget Code
Google Pagerank
PR 0 out of 10
PageSpeed Score
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
DMOZ Listing: No

Web Server Information

Hosted IP Address:

Hosted Country:

United States US

Location Latitude:


Location Longitude:

Katy, TX Equipment Rental Agency | Equipment Rental Service 77450 | Sensory Playground
Call Sensory Playground at 832-944-5559 now for exceptional Equipment Rental Service service in Katy, TX!

Page Resources Breakdown

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 2
H3 Headings: 1 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 2
Google Adsense: Not Applicable Google Analytics: UA-42382341-1

Websites Hosted on Same IP (i.e.

Alternative Medicine Practitioner Serving Chicago, IL

- antiageingsolutionschicago.com

Call Dr. Eunice Deane, DC at 773-657-2356 now for exceptional Chiropractor service in Chicago, IL!

  Not Applicable   $ 8.95

Portsmouth, RI Hvac Contractor | HVAC Contractor 02871 | Aquidneck...

- portsmouthhvacservice.com

Call Aquidneck Services LLC now at 401-400-3873 for quality Portsmouth, RI HVAC Contractor services.

  Not Applicable   $ 8.95

Pittsfield, MA Handyman | Handyman Service 01201 | John's Painting...

- pittsfieldmahandymanservices.com

Call John's Painting & Property Maintenance in Pittsfield, MA at 413-344-0332 now for Handyman Service services you can rely on!

  Not Applicable   $ 8.95

Pine Bluff, AR Roofing Contractor | Roofer 71603 | All In 1...

- pinebluffarroofingcompany.com

Call All In 1 Properties, LLC now at 501-313-0974 for quality Pine Bluff, AR Roofer services.

  Not Applicable   $ 8.95

Pensacola, FL Accountant | Accountant 32533 | Take Flight Business...

- pensacolaflaccounting.com

Please call Take Flight Business Solutions LLC now at 850-462-5698 for quality Accountant services in Pensacola, FL.

  Not Applicable   $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 19 Nov 2016 10:45:25 GMT
Server: Apache/2.4.6 (Red Hat Enterprise Linux)
Last-Modified: Fri, 18 Nov 2016 01:40:26 GMT
ETag: "8f1c-5418963e79680-gzip"
Accept-Ranges: bytes
Vary: Accept-Encoding
Content-Encoding: gzip
Cache-Control: max-age=691200
Expires: Sun, 27 Nov 2016 10:45:25 GMT
Content-Length: 7204
Connection: close
Content-Type: text/html

Domain Information

Domain Registrar: ENOM, INC.
Registration Date: 2016-11-17 2 months 4 weeks 4 days ago
Last Modified: 2016-11-17 2 months 4 weeks 4 days ago
Expiration Date: 2017-11-17 8 months 3 weeks 3 days from now
Domain Status:

Domain Nameserver Information

Host IP Address Country
ns3a.dns-host.com United States United States
ns3b.dns-host.com United States United States

DNS Record Analysis

Host Type TTL Extra
katypartysupply.com A 14399 IP:
katypartysupply.com NS 3599 Target: ns3a.dns-host.com
katypartysupply.com NS 3599 Target: ns3b.dns-host.com
katypartysupply.com SOA 3599 MNAME: ns3a.dns-host.com
RNAME: hostmaster.katypartysupply.com
Serial: 2016111701
Refresh: 10800
Retry: 3600
Expire: 604800
katypartysupply.com MX 14399 Priority: 10
Target: clientmx.natpal.com

Similarly Ranked Websites


- google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

  1   $ 8,833,062,960.00

Google Photos - All your photos organized and easy to find

- photos.google.com

All your photos are backed up safely, organized and labeled automatically, so you can find them fast, and share them how you like.

  1   $ 8,833,062,960.00

Google Sites

- sites.google.com

Thinking of creating a website? Google Sites is a free and easy way to create and share webpages.

  1   $ 8,833,062,960.00

Collections - Google+

- plus.google.com

Discover amazing things and connect with passionate people.

  1   $ 8,833,062,960.00

Google Help

- support.google.com

  1   $ 8,833,062,960.00

Alexa Traffic Rank

Alexa Search Engine Traffic

Full WHOIS Lookup

Registry Domain ID: 2074801154_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: www.enom.com
Updated Date: 2016-11-17T06:58:36.00Z
Creation Date: 2016-11-17T14:58:00.00Z
Registrar Registration Expiration Date: 2017-11-17T14:58:00.00Z
Registrar: ENOM, INC.
Registrar IANA ID: 48
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Organization: YODLE
Registrant Street: 330 W34TH ST
Registrant Street: 18TH FL
Registrant City: NEW YORK
Registrant State/Province: NY
Registrant Postal Code: 10001
Registrant Country: US
Registrant Phone: +1.8772765104
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registry Admin ID:
Admin Organization: YODLE
Admin Street: 330 W34TH ST
Admin Street: 18TH FL
Admin City: NEW YORK
Admin State/Province: NY
Admin Postal Code: 10001
Admin Country: US
Admin Phone: +1.8772765104
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Registry Tech ID:
Tech Organization: YODLE
Tech Street: 330 W34TH ST
Tech Street: 18TH FL
Tech City: NEW YORK
Tech State/Province: NY
Tech Postal Code: 10001
Tech Country: US
Tech Phone: +1.8772765104
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Name Server: NS3A.DNS-HOST.COM
Name Server: NS3B.DNS-HOST.COM
DNSSEC: unSigned
Registrar Abuse Contact Email: abuse@enom.com
Registrar Abuse Contact Phone: +1.4252982646
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2016-11-17T06:58:36.00Z

Comments / Ratings / Reviews / Feedbacks for katypartysupply.com